Plant Transcription Factor Database
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc04076.1.g00070.1
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family HSF
Protein Properties Length: 715aa    MW: 77393.5 Da    PI: 7.6158
Description HSF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
                  HSF_DNA-bind   2 FlkklyeiledeelkeliswsengnsfvvldeeefakkvLpkyFkhsnfaSFvRQLnmYg 61 
                                   Fl+k+y+++++++l+  isw + gns+vv+d+++fa++vLp +Fkh+nf+ FvRQLn+Y  70 FLSKTYDLVSEPALDGAISWGAAGNSIVVWDPSTFARDVLPYHFKHNNFSTFVRQLNTYS 129
                                   9**********************************************************5 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004156.0E-2466171IPR000232Heat shock factor (HSF)-type, DNA-binding
Gene3DG3DSA: helix-turn-helix DNA-binding domain
SuperFamilySSF467857.35E-2068129IPR011991Winged helix-turn-helix DNA-binding domain
PfamPF004475.5E-1870129IPR000232Heat shock factor (HSF)-type, DNA-binding
PRINTSPR000566.9E-107093IPR000232Heat shock factor (HSF)-type, DNA-binding
PRINTSPR000566.9E-10108120IPR000232Heat shock factor (HSF)-type, DNA-binding
PRINTSPR000566.9E-10121133IPR000232Heat shock factor (HSF)-type, DNA-binding
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 715 aa     Download sequence    Send to blast
3D Structure ? help Back to Top
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2ldu_A6e-16621281178Heat shock factor protein 1
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002453922.10.0hypothetical protein SORBIDRAFT_04g021490
SwissprotQ6H6Q70.0HSFA3_ORYSJ; Heat stress transcription factor A-3
TrEMBLC5XTC90.0C5XTC9_SORBI; Putative uncharacterized protein Sb04g021490
STRINGSb04g021490.10.0(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number